General Information

  • ID:  hor004026
  • Uniprot ID:  Q6DQW2
  • Protein name:  Pyrokinin
  • Gene name:  CAPA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TEGPGMWFGPRL
  • Length:  12(100-111)
  • Propeptide:  MQSAVRLVVCLFLLSSVLGGSYQSGPKLRRDGVLNLYPFPRVGRASHHTWQIPINDLYLEYDPVDKRQLYAFPRVGRSELSLLRPEQHLDALQPVPARRTEGPGMWFGPRLGRSFKSDEDEITIQNNNLERSEPELMERKKRNAHLN
  • Signal peptide:  MQSAVRLVVCLFLLSSVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DQW2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004026_AF2.pdbhor004026_ESM.pdb

Physical Information

Mass: 154393 Formula: C62H90N16O16S
Absent amino acids: ACDHIKNQSVY Common amino acids: G
pI: 6.41 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -45.83 Boman Index: -890
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 1893.33 Extinction Coefficient cystines: 5500
Absorbance 280nm: 500

Literature

  • PubMed ID:  19350635
  • Title:  Identification of Novel Neuropeptides in the Ventral Nerve Cord Ganglia and Their Targets in an Annelid Worm, Eisenia Fetida