General Information

  • ID:  hor004013
  • Uniprot ID:  A0A3R7MI09
  • Protein name:  pyrokinin
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  ADFAFSPRL
  • Length:  9(308-316)
  • Propeptide:  MHALTLTVAALTFLSLAKCSTLTAADTQDALPGYQPRDFSNLAQDDRSLRMFLDFLLNSQQPSPMMGEPLEDSDEGYRRKRSVNTSQEEDVRKEENEETRDKRQTKEEKDEEGETAEEQSGSWWWRPVEERRSYFIPRLGKRDGNDIPALASENDLDNMEYLDDDEVDSGDAEALREEEDPTGEVEKDEDEQDAWAGFGSPLDKRDFAFNPRLGKRQTFTPRLGKRDFAFSPRLGKRDFAFSPRLGKRDFAFNPR
  • Signal peptide:  MHALTLTVAALTFLSLAKC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3R7MI09-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004013_AF2.pdbhor004013_ESM.pdb

Physical Information

Mass: 116603 Formula: C48H70N12O13
Absent amino acids: CEGHIKMNQTVWY Common amino acids: AF
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 28.89 Boman Index: -1254
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.56
Instability Index: 3152.22 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19852991
  • Title:  Combining in Silico Transcriptome Mining and Biological Mass Spectrometry for Neuropeptide Discovery in the Pacific White Shrimp Litopenaeus Vannamei