General Information

  • ID:  hor004009
  • Uniprot ID:  A0A4D5SAC8
  • Protein name:  Pyrokinin-2
  • Gene name:  NA
  • Organism:  Ixodes scapularis (Black-legged tick) (Deer tick)
  • Family:  Glycosyl hydrolase 2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ixodes (genus), Ixodinae (subfamily), Ixodidae (family), Ixodoidea (superfamily), Ixodida (order), Parasitiformes (superorder), Acari (subclass), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003824 catalytic activity; GO:0004567 beta-mannosidase activity
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GSFVPRL
  • Length:  7
  • Propeptide:  MLHYFAVRFFAPLLVSAYVDGDRLLVYAIDDLYAGEPYNLRLDVRLYHYGSFVPRLSLTHVFPMSSLVQVVSAKNLSELLSSASCSRNNSFLTFRLSNDSDGETLSSNFLLLQVPRLATEIPSAALKISNVSALHSEDESLRGCNVHEIELKTDAVALFVWLSAGRVRGRFSDNGFIMVDKTTSLTFTSDLPLDVAQLRLNISVTCLNCLRHAGYSPMADIKTQ
  • Signal peptide:  MLHYFAVRFFAPLLVSAYVDG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A4D5SAC8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004009_AF2.pdbhor004009_ESM.pdb

Physical Information

Mass: 88211 Formula: C36H58N10O9
Absent amino acids: ACDEHIKMNQTWY Common amino acids: FGLPRSV
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 50 Boman Index: -544
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.14
Instability Index: 2531.43 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19540946
  • Title:  The Neuropeptidomics of Ixodes Scapularis Synganglion