General Information

  • ID:  hor004006
  • Uniprot ID:  A0A6J1WVN5
  • Protein name:  Alpha-SG neuropeptide
  • Gene name:  LOC113519120
  • Organism:  Galleria mellonella (Greater wax moth)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Galleria (genus), Galleriinae (subfamily), Pyralidae (family), Pyraloidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VIFTPKL
  • Length:  7(97-103)
  • Propeptide:  MLSMNNVVCLFVVILYSNIVLCDDLKEDNIDRGAHSDRNGLWFGPRLGKRSLSISHEDNRPFLRLLEAADALKYYYDQLPYYEAQADEPEAKVTKKVIFTPKLGRSLDGYSDKQAYENVDFTPRLGRRLADDMPATPPDQDLYRPDPEQLSRKYFSPRLGRNVNLTPRLGRELYEIYPGKIRVVRSANKTTSS
  • Signal peptide:  MLSMNNVVCLFVVILYSNIVLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6J1WVN5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004006_AF2.pdbhor004006_ESM.pdb

Physical Information

Mass: 92424 Formula: C41H68N8O9
Absent amino acids: ACDEGHMNQRSWY Common amino acids: FIKLPTV
pI: 9.7 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 130 Boman Index: 874
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 152.86
Instability Index: -355.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15706623
  • Title:  Mass Spectrometric Analysis of Head Ganglia and Neuroendocrine Tissue of Larval Galleria Mellonella (Arthropoda, Insecta)