General Information

  • ID:  hor003979
  • Uniprot ID:  Q9QXV0
  • Protein name:  PEN-19
  • Gene name:  Pcsk1n
  • Organism:  Mus musculus (Mouse)
  • Family:  ProSAAS family
  • Source:  Animal
  • Expression:  Broadly expressed from 9 dpc to 11 dpc, with some enrichment in neural tube-derived tissues. By 15 dpc, the expression is largely restricted to neuroendocrine tissues. |Expressed in brain (mostly hypothalamus and pituitary) and gut. Expressed in trigemina
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity
  • GO BP:  GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SVDQDLGPEVPPENVLGAL
  • Length:  19(219-237)
  • Propeptide:  MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLVETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAAAPRPRPPVYDDGPTGPDVEDAGDETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRSVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRL
  • Signal peptide:  MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  be implicated in the regulation of feeding
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Pcsk1
  • Target Unid:  Q9QXV0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9QXV0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003979_AF2.pdbhor003979_ESM.pdb

Physical Information

Mass: 227040 Formula: C85H137N21O31
Absent amino acids: CFHIKMRTWY Common amino acids: LPV
pI: 3.29 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 7
Hydrophobicity: -8.42 Boman Index: -1607
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 112.63
Instability Index: 4580 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11094058
  • Title:  ProSAAS Processing in Mouse Brain and Pituitary