HORDB

ID: hor003978
Uniprot ID: Q9QXV0
Protein name: PEN
Gene name: Pcsk1n
Organism: Mus musculus (Mouse)
Family: ProSAAS family
Source: animal
Expression: Broadly expressed from 9 dpc to 11 dpc, with some enrichment in neural tube-derived tissues. By 15 dpc, the expression is largely restricted to neuroendocrine tissues. |Expressed in brain (mostly hypothalamus and pituitary) and gut. Expressed in trigemina
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity
GO BP: GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence: SVDQDLGPEVPPENVLGALLRV
Length: 22
Propeptide: MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLVETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAAAPRPRPPVYDDGPTGPDVEDAGDETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRSVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRLLPP
Signal peptide: MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003978_AF2.pdb

hor003978_ESM.pdb

Mass:	269239	Formula:	C102H169N27O34
Absent amino acids:	CFHIKMTWY	Common amino acids:	LV
pI:	3.74	Basic residues:	1
Polar residues:	4	Hydrophobic residues:	9
Hydrophobicity:	8.64	Boman Index:	-2203
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	128.18
Instability Index:	4967.27	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 11094058
Title: ProSAAS Processing in Mouse Brain and Pituitary
PubMed ID: 27117253
Title: Identification of GPR83 as the Receptor for the Neuroendocrine Peptide PEN