HORDB

ID: hor003977
Uniprot ID: Q9QXV0
Protein name: Little SAAS
Gene name: Pcsk1n
Organism: Mus musculus (Mouse)
Family: ProSAAS family
Source: Animal
Expression: Broadly expressed from 9 dpc to 11 dpc, with some enrichment in neural tube-derived tissues. By 15 dpc, the expression is largely restricted to neuroendocrine tissues. |Expressed in brain (mostly hypothalamus and pituitary) and gut. Expressed in trigemina
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity
GO BP: GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence: SLSAASAPLVETSTPLRL
Length: 18(42-59)
Propeptide: MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLVETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAAAPRPRPPVYDDGPTGPDVEDAGDETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRSVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRL
Signal peptide: MAGSPLLCGPRAGGVGILVLLLLGLLRLPPTLS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the processed peptides reduce PCSK1 activity in t
Mechanism: NA
Cross BBB: NA
Target: Pcsk1
Target Unid: Q9QXV0
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003977_AF2.pdb

hor003977_ESM.pdb

Mass:	211648	Formula:	C79H137N21O27
Absent amino acids:	CDFGHIKMNQWY	Common amino acids:	LS
pI:	6.41	Basic residues:	1
Polar residues:	6	Hydrophobic residues:	8
Hydrophobicity:	50	Boman Index:	-1132
Half-Life / Aliphatic Index:	1.9 hour	Aliphatic Index:	119.44
Instability Index:	3084.44	Extinction Coefficient cystines:	0
Absorbance 280nm:	0