HORDB

ID: hor003916
Uniprot ID: P01192
Protein name: Lipotropin beta
Gene name: pomc
Organism: Sus scrofa (Pig)
Family: POMC family
Source: Animal
Expression: ACTH and MSH are produced by the pituitary gland.
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:2000852 regulation of corticosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Length: 91(177-267)
Propeptide: MPRLCGSRSGALLLTLLLQASMGVRGWCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQKREEEEVAAGEGPGPRGDGVAPGPRQDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEFRRELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFK
Signal peptide: MPRLCGSRSGALLLTLLLQASMGVRG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
Mechanism: NA
Cross BBB: NA
Target: MC4R, MC3R
Target Unid: O97504, A5GFS7
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003916_AF2.pdb

hor003916_ESM.pdb

Mass:	1150061	Formula:	C439H684N122O135S2
Absent amino acids:	C	Common amino acids:	A
pI:	6.54	Basic residues:	16
Polar residues:	19	Hydrophobic residues:	28
Hydrophobicity:	-89.56	Boman Index:	-18279
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	51.76
Instability Index:	4038.68	Extinction Coefficient cystines:	9970
Absorbance 280nm:	110.78