General Information

  • ID:  hor003913
  • Uniprot ID:  P01192
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Sus scrofa (Pig)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:2000852 regulation of corticosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
  • Length:  39(136-174)
  • Propeptide:  MPRLCGSRSGALLLTLLLQASMGVRGWCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQKREEEEVAAGEGPGPRGDGVAPGPRQDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEFRRELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFK
  • Signal peptide:  MPRLCGSRSGALLLTLLLQASMGVRG
  • Modification:  T1 N-acetylserine;T13 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MC4R, MC3R
  • Target Unid:   O97504, A5GFS7
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01192-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003913_AF2.pdbhor003913_ESM.pdb

Physical Information

Mass: 524515 Formula: C210H314N56O57S
Absent amino acids: CIQT Common amino acids: E
pI: 9.08 Basic residues: 8
Polar residues: 8 Hydrophobic residues: 12
Hydrophobicity: -86.15 Boman Index: -8428
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 50
Instability Index: 4873.85 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  2174774
  • Title:  Isolation and Full Structural Characterisation of Six Adrenocorticotropin-Like Peptides From Porcine Pituitary Gland. Identification of Three Novel Fragments of Adrenocorticotropin and of Two Forms of a Novel Adrenocorticotropin-Like Peptide