General Information

  • ID:  hor003909
  • Uniprot ID:  P01197
  • Protein name:  Melanocyte-stimulating hormone alpha
  • Gene name:  pomc
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPM
  • Length:  13(1-13)
  • Propeptide:  SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL
  • Signal peptide:  NA
  • Modification:  T13 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01197-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003909_AF2.pdbhor003909_ESM.pdb

Physical Information

Mass: 187011 Formula: C75H106N20O19S2
Absent amino acids: ACDILNQTV Common amino acids: MS
pI: 9.3 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -110 Boman Index: -2793
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 1340.77 Extinction Coefficient cystines: 6990
Absorbance 280nm: 582.5

Literature

  • PubMed ID:  4375977
  • Title:  The isolation and amino acid sequence of an adrenocorticotrophin from the pars distalis and a corticotrophin-like intermediate-lobe peptide from the neurointermediate lobe of the pituitary of the dogfish Squalus acanthias.
  • PubMed ID:  5476715
  • Title:  Purification and amino acid seq