General Information

  • ID:  hor003888
  • Uniprot ID:  P10000
  • Protein name:  Melanocyte-stimulating hormone alpha
  • Gene name:  pomc
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPIGH
  • Length:  15(98-112)
  • Propeptide:  MVCAPWLLAVVVVCVCNPGVGGQCWDSSHCKDLPSEDKILECTHLFRSGLQDESPEPRSAAQQSTEESLSLGILLAALTSGERALDADPEPHSDKRHSYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQARRQLGSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTKQSHKPLITLLKHITLKNEQ
  • Signal peptide:  MVCAPWLLAVVVVCVCNPGVGG
  • Modification:  T1 N-acetylserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10000-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003888_AF2.pdbhor003888_ESM.pdb

Physical Information

Mass: 208195 Formula: C84H118N24O21S
Absent amino acids: ACDLNQTV Common amino acids: GHS
pI: 9.3 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -102 Boman Index: -2908
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 26
Instability Index: 1798 Extinction Coefficient cystines: 6990
Absorbance 280nm: 499.29

Literature

  • PubMed ID:  7447938
  • Title:  Isolation and Structure of Another Beta-Melanotropin From Salmon Pituitary Glands