General Information

  • ID:  hor003866
  • Uniprot ID:  P21252
  • Protein name:  Beta-endorphin
  • Gene name:  pomc
  • Organism:  Loxodonta africana (African elephant)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Loxodonta (genus), Elephantidae (family), Proboscidea (order), Afrotheria (superorder), Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
  • Length:  31(104-134)
  • Propeptide:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEFXXELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous orexigenic opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003866_AF2.pdbhor003866_ESM.pdb

Physical Information

Mass: 400833 Formula: C159H251N41O44S
Absent amino acids: CDRW Common amino acids: K
pI: 10.48 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -44.84 Boman Index: -3436
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 66.13
Instability Index: 935.16 Extinction Coefficient cystines: 2980
Absorbance 280nm: 99.33

Literature

  • PubMed ID:  2854538
  • Title:  Isolation and primary structures of elephant adrenocorticotropin and beta-lipotropin.