General Information

  • ID:  hor003863
  • Uniprot ID:  P21252
  • Protein name:  Lipotropin beta
  • Gene name:  pomc
  • Organism:  Loxodonta africana (African elephant)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Loxodonta (genus), Elephantidae (family), Proboscidea (order), Afrotheria (superorder), Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
  • Length:  93(42-134)
  • Propeptide:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEFXXELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003863_AF2.pdbhor003863_ESM.pdb

Physical Information

Mass: 1188858 Formula: C449H704N128O143S2
Absent amino acids: C Common amino acids: AEK
pI: 6.54 Basic residues: 17
Polar residues: 24 Hydrophobic residues: 25
Hydrophobicity: -102.26 Boman Index: -22490
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 50.54
Instability Index: 2895.91 Extinction Coefficient cystines: 9970
Absorbance 280nm: 108.37

Literature

  • PubMed ID:  2854538
  • Title:  Isolation and primary structures of elephant adrenocorticotropin and beta-lipotropin.