General Information

  • ID:  hor003854
  • Uniprot ID:  Q9YGK5
  • Protein name:  Melanocyte-stimulating hormone alpha
  • Gene name:  pomcb
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGR
  • Length:  15(108-122)
  • Propeptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRAQCWEDARCRDLTTDENILNCIQLCRSDLTDETPVYPGESHLQPPSELEQAEVLEPLSPAALAPAEQMDPESSPRHELKRSYSMEHFRWGKPVGRKRRPIKVYTNGVEEESAESLPAEMRRELATNEVNHPQEDSALIQQKKKDGSYKMKHFRWSSPPAGKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Signal peptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003854_AF2.pdbhor003854_ESM.pdb

Physical Information

Mass: 208696 Formula: C83H121N25O21S
Absent amino acids: ACDILNQT Common amino acids: GRS
pI: 10.45 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -112.67 Boman Index: -4022
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 19.33
Instability Index: 2516 Extinction Coefficient cystines: 6990
Absorbance 280nm: 499.29

Literature

  • PubMed ID:  9806347
  • Title:  Cloning and expression of two proopiomelanocortin mRNAs in the common carp (Cyprinus carpio L.).