General Information

  • ID:  hor003834
  • Uniprot ID:  P19402
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF
  • Length:  39(125-163)
  • Propeptide:  MPRSCYSRSGTLLLALLLQISMEVRGWCLESSQCQDLTTERHLLECLRACKPDLSAETPVFPGGADEQTPTESPRKYVTGHFRWGRFGRGNSSGASQKREEEAAAADPGFHGDGVEPGLREDKRSYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEFKRELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKGKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKG
  • Signal peptide:  MPRSCYSRSGTLLLALLLQISMEVRG
  • Modification:  T1 N-acetylserine;T13 Valine amide;T31 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Mc4r, Mc2r
  • Target Unid:  A8QXQ6, Q9Z1S9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19402-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003834_AF2.pdbhor003834_ESM.pdb

Physical Information

Mass: 520705 Formula: C206H308N56O58S
Absent amino acids: CDIQT Common amino acids: E
pI: 9.08 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -89.23 Boman Index: -8888
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 42.56
Instability Index: 6836.41 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  2830360
  • Title:  Isolation, amino acid sequence and action of guinea-pig ACTH on aldosterone production by glomerulosa cells.