General Information

  • ID:  hor003829
  • Uniprot ID:  P68001
  • Protein name:  Corticotropin-like intermediary peptide
  • Gene name:  pomc
  • Organism:  Balaenoptera physalus (Fin whale) (Balaena physalus)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PVKVYPNGAEDESAEAFPLEF
  • Length:  21(19-39)
  • Propeptide:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • Signal peptide:  NA
  • Modification:  T13 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Precursor protein for pituitary hormones that regulate stress and environmental adaptation.; [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of s
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68001-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003829_AF2.pdbhor003829_ESM.pdb

Physical Information

Mass: 266642 Formula: C106H153N23O35
Absent amino acids: CHIMQRTW Common amino acids: E
pI: 3.67 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 8
Hydrophobicity: -42.86 Boman Index: -2636
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 60.48
Instability Index: 3188.1 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  NA
  • Title:  Primary structure of the corticotropin of whalebone whales, finbacks (Balaenoptera physalus).