General Information

  • ID:  hor003824
  • Uniprot ID:  P68000
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Balaenoptera borealis (Sei whale) (Pollack whale)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • Length:  39(1-39)
  • Propeptide:  SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T13 Valine amide;T31 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68000-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P68000-F1.pdbhor003824_AF2.pdbhor003824_ESM.pdb

Physical Information

Mass: 521906 Formula: C207H308N56O58S
Absent amino acids: CIQT Common amino acids: E
pI: 9.08 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -97.95 Boman Index: -9260
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 40
Instability Index: 5367.69 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  201308
  • Title:  [Amino Acid Sequence of Corticotropins From Seiwhale (Balaenoptera Borealis) and Pinwhale (Balaenoptera Physalus)]