HORDB

ID: hor003823
Uniprot ID: P87352
Protein name: Beta-endorphin
Gene name: pomc
Organism: Acipenser transmontanus (White sturgeon)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Acipenser (genus), Acipenserini (tribe), Acipenserinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: YGGFMKSWDERSQKPLLTLFKNVMIKDGHEKKGQ
Length: 34
Propeptide: MLHPVWGCVVAVMGVLWFYSSGVQSQCWEHSQCRDLASEANILECIQACKVDLSAESPLFPGNGHLQPTSEDIQNYVMSHFHWNTFGQRMNGTPGGSKREGASTALSVLLEALSQPRDEVERESEEEEGLQQHRRDDKRSYSMEHFRWGKPVGRKRRPVKVYPNGVEEESAESYPAEIRRDLSLKLDYPQGEELEEVFGGENDLLNLQKKDGSYKMNHFRWSGPPKDKRYGGFMKSWDERSQKPLLTLFKNVMIKDGHEKKGQ
Signal peptide: MLHPVWGCVVAVMGVLWFYSSGVQS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003823_AF2.pdb

hor003823_ESM.pdb

Mass:	458644	Formula:	C180H283N49O50S2
Absent amino acids:	AC	Common amino acids:	K
pI:	10.29	Basic residues:	8
Polar residues:	9	Hydrophobic residues:	8
Hydrophobicity:	-99.41	Boman Index:	-7070
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	54.41
Instability Index:	1779.41	Extinction Coefficient cystines:	6990
Absorbance 280nm:	211.82