General Information

  • ID:  hor003555
  • Uniprot ID:  A0A3S8RK75
  • Protein name:  CAPA-Periviscerokinin-2
  • Gene name:  NA
  • Organism:  Nezara viridula (Southern green stink bug) (Cimex viridulus)
  • Family:  Periviscerokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nezara (genus), Pentatominae (subfamily), Pentatomidae (family), Pentatomoidea (superfamily), Pentatomomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  EQLIPFPRV
  • Length:  9(70-78)
  • Propeptide:  NVFYLVASLFLLLSCSRAAPGLKTVSQACTREKRDAGLFPFPRVGRTFPLTWSFLPLVEPESGERQIKREQLIPFPRVGKSGPKRNGASGNGGLWFGPRLGRLSKRMELVPISYRQENNVPENLLKNSPVKGIGNSNDIDDYIDSKQ
  • Signal peptide:  NVFYLVASLFLLLSCSRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3S8RK75-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003555_AF2.pdbhor003555_ESM.pdb

Physical Information

Mass: 124118 Formula: C52H83N13O13
Absent amino acids: ACDGHKMNSTWY Common amino acids: P
pI: 6.41 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 4
Hydrophobicity: 6.67 Boman Index: -1041
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 118.89
Instability Index: 6151.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18201800
  • Title:  Comparative Peptidomics of Four Related Hemipteran Species: Pyrokinins, Myosuppressin, Corazonin, Adipokinetic Hormone, sNPF, and Periviscerokinins