General Information

  • ID:  hor003553
  • Uniprot ID:  Q6DQW2
  • Protein name:  Periviscerokinin-2
  • Gene name:  CAPA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLYAFPRV
  • Length:  8
  • Propeptide:  MQSAVRLVVCLFLLSSVLGGSYQSGPKLRRDGVLNLYPFPRVGRASHHTWQIPINDLYLEYDPVDKRQLYAFPRVGRSELSLLRPEQHLDALQPVPARRTEGPGMWFGPRLGRSFKSDEDEITIQNNNLERSEPELMERKKRNAHLN
  • Signal peptide:  MQSAVRLVVCLFLLSSVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DQW2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003553_AF2.pdbhor003553_ESM.pdb

Physical Information

Mass: 111821 Formula: C48H72N12O11
Absent amino acids: CDEGHIKMNSTW Common amino acids: AFLPQRVY
pI: 9.35 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 21.25 Boman Index: -685
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.5
Instability Index: 5300 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  19350635
  • Title:  Identification of Novel Neuropeptides in the Ventral Nerve Cord Ganglia and Their Targets in an Annelid Worm, Eisenia Fetida