General Information

  • ID:  hor003545
  • Uniprot ID:  E9G007
  • Protein name:  Periviscerokinin-3
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Periviscerokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  QNLIPFPRV
  • Length:  9
  • Propeptide:  MRIAIIHSLVLVVIYLAYSDAAPPQILKSQSLIPFPRVGRSRSSFIANAVGSARSGGAGNPMMMGSGGNANGKSPNNWMMNNADIKRHLIPFPRVGKRQNLIPFPRVGRAGYYQPGFFPSTDDEEGQASIQQQFALSSEESQASAPSSFLMSGSDILGALNNGRSNSDERTAVFIPRRWMTNSQESEE
  • Signal peptide:  MRIAIIHSLVLVVIYLAYSDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E9G007-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003545_AF2.pdbhor003545_ESM.pdb

Physical Information

Mass: 122617 Formula: C51H82N14O12
Absent amino acids: ACDEGHKMSTWY Common amino acids: P
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 6.67 Boman Index: -1024
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 118.89
Instability Index: 4011.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones