General Information

  • ID:  hor003538
  • Uniprot ID:  A0A6I8T824
  • Protein name:  CAPA-Periviscerokinin-1
  • Gene name:  5566490
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPTVGLFAFPRV
  • Length:  12
  • Propeptide:  MQQVTQFKTLAYVSLVFVVLSAVKFCRADASDLDSVSEGRHKRGPTVGLFAFPRVGRSDPDLLEWSDAAAVAAALPLELADDYEDYPIREAKRQGLVPFPRVGRSGMNAARFYWPKTMMPQQQKRAGNSGANSGMWFGPRLGKRANAASTEIKGTEVYTPRLGRNSERPQIGESGDLNARSSSRSKLEDFERLFRSSDN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6I8T824-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003538_AF2.pdbhor003538_ESM.pdb

Physical Information

Mass: 145688 Formula: C61H93N15O14
Absent amino acids: CDEHIKMNQSWY Common amino acids: FGPV
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: 86.67 Boman Index: 516
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 89.17
Instability Index: 1185.83 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti