General Information

  • ID:  hor003528
  • Uniprot ID:  Q9GLF6
  • Protein name:  Orexin-B
  • Gene name:  HCRT
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Orexin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031771 type 1 orexin receptor binding; GO:0031772 type 2 orexin receptor binding
  • GO BP:  GO:0001659 temperature homeostasis; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0030431 sleep; GO:0042594 response to starvation; GO:0042755 eating behavior; GO:0046928 regulation of neurotransmitter secretion; GO:0051971 positive regulation of transmission of nerve impulse; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005791 rough endoplasmic reticulum; GO:0031410 cytoplasmic vesicle; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  RPGPPGLQGRLQRLLQASGNHAAGILTM
  • Length:  28(69-96)
  • Propeptide:  MNPPSTKVPWAAVTLLLLLLLPPALLSPGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCPGRRCPVVAVPSAAPGGRSGV
  • Signal peptide:  MNPPSTKVPWAAVTLLLLLLLPPALLSPGAAA
  • Modification:  T28 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  HCRTR2
  • Target Unid:  Q9TUP7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GLF6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003528_AF2.pdbhor003528_ESM.pdb

Physical Information

Mass: 339219 Formula: C125H213N43O35S
Absent amino acids: CDEFKVWY Common amino acids: GL
pI: 12.8 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -29.29 Boman Index: -3665
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 94.29
Instability Index: 5914.29 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11282968
  • Title:  Identification and Functional Analysis of Mutations in the Hypocretin (Orexin) Genes of Narcoleptic Canines