General Information

  • ID:  hor003414
  • Uniprot ID:  A0A8J5MPT9
  • Protein name:  Orcokinin
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  NFDEIDRSGF
  • Length:  10(12-21)
  • Propeptide:  MDRLGFGFNKRNFDEIDRSGFGFHKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFHKRGDYDVYPEKRNFDEIDRSGFGFVKRVYGPRDIANLYKRNFDEIDRSGFGFVRRSAE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003414_AF2.pdbhor003414_ESM.pdb

Physical Information

Mass: 135995 Formula: C52H74N14O19
Absent amino acids: ACHKLMPQTVWY Common amino acids: DF
pI: 3.88 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -96 Boman Index: -3739
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 6197 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20025296
  • Title:  Mass Spectral Analysis of Neuropeptide Expression and Distribution in the Nervous System of the Lobster Homarus Americanus