General Information

  • ID:  hor003337
  • Uniprot ID:  A0A0K0QPL7
  • Protein name:  Orcokinin
  • Gene name:  NA
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  NFDEIDRSGFNS
  • Length:  12
  • Propeptide:  MKLLALLVVTIAATSVPSSASPIQSDALRESAFRDYRADSGDEENVVRHLDSIGGGHLLRELDGLSHFPRRTRSGLDSLSGASFGGNKRFDTLSGISFGNQKRNFDEIDRSGFNSFVKKNLDEIDRSGFDSFVKRNFDEIDRVGFGSFVKRNAPLFLTRYYDKQENH
  • Signal peptide:  MKLLALLVVTIAATSVPSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity;mediated the transmission of light and stimulated the neurons of the accessory medulla involved in the circadian clock.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0K0QPL7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003337_AF2.pdbhor003337_ESM.pdb

Physical Information

Mass: 159680 Formula: C59H85N17O23
Absent amino acids: ACHKLMPQTVWY Common amino acids: DFNS
pI: 3.88 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -115.83 Boman Index: -4743
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 5255.83 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15522610
  • Title:  Orcokinins in Insects and Other Invertebrates