General Information

  • ID:  hor003335
  • Uniprot ID:  P07194
  • Protein name:  Synenkephalin
  • Gene name:  penk-b
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ACTLECEGKLPSAKAWGTCKELLQLTKLDGVQDGEKYQDNNDSHYIA
  • Length:  47(1-47)
  • Propeptide:  ACTLECEGKLPSAKAWGTCKELLQLTKLDGVQDGEKYQDNNDSHYIAKKYGGFMKRYGGFMKKMDELYHAEPEEDDAGGEILAKNYGGFMKKEYDSNRDASDLLRELLATSGDPESAIYHDNNSETPGEMNKRYGGFMRGYRRSTDLEDETRGIQKRYGGFMRRVGRPEWWQDYQKRYGGFMTRFTDSFLPSDEDGESYSKENPDMEKRYGGFMRF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enkephalin neuropeptides compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07194-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003335_AF2.pdbhor003335_ESM.pdb

Physical Information

Mass: 600651 Formula: C223H352N60O76S3
Absent amino acids: FMR Common amino acids: L
pI: 4.51 Basic residues: 6
Polar residues: 16 Hydrophobic residues: 13
Hydrophobicity: -68.94 Boman Index: -8357
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 72.77
Instability Index: 6115.96 Extinction Coefficient cystines: 8605
Absorbance 280nm: 187.07

Literature

  • PubMed ID:  6547769
  • Title:  Polymorphism and Absence of Leu-enkephalin Sequences in Proenkephalin Genes in Xenopus Laevis