HORDB

ID: hor003308
Uniprot ID: P06300
Protein name: Dynorphin A(1-17)
Gene name: Pdyn
Organism: Rattus norvegicus (Rat)
Family: Opioid neuropeptide precursor family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity; GO:0005515 protein binding; GO:0031628 opioid receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007600 sensory perception; GO:0035094 response to nicotine; GO:0035902 response to immobilization stress
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005886 plasma membrane; GO:0008021 synaptic vesicle; GO:0030425 dendrite; GO:0031045 dense core granule; GO:0043025 neuronal cell body; GO:0043197 dendritic spine; GO:0043679 axon terminus; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle; GO:0099013 neuronal dense core vesicle lumen

Sequence: YGGFLRRIRPKLKWDNQ
Length: 17(202-218)
Propeptide: MAWSRLMLAACLLVIPSEVAADCLSLCSLCAVRTQDGPHPINPLICSLECQDLVPPSEEWETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTALTKLLEPLLKELEKGQLLTSVSEEKLRGLSSRFGNGRESELLGTDLMNDEAAQAGTLHFNEEDLRKQAKRYGGFLRKYPKRSSEMTGDEDRGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPNTYSEDLDV
Signal peptide: MAWSRLMLAACLLVIPSEVAA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (By similarity).
Mechanism: NA
Cross BBB: NA
Target: Oprk1
Target Unid: P34975
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003308_AF2.pdb

hor003308_ESM.pdb

Mass:	243308	Formula:	C99H155N31O23
Absent amino acids:	ACEHMSTV	Common amino acids:	R
pI:	11.58	Basic residues:	5
Polar residues:	4	Hydrophobic residues:	5
Hydrophobicity:	-126.47	Boman Index:	-5495
Half-Life / Aliphatic Index:	2.8 hour	Aliphatic Index:	68.82
Instability Index:	5360.59	Extinction Coefficient cystines:	6990
Absorbance 280nm:	436.88