General Information

  • ID:  hor003291
  • Uniprot ID:  P50175
  • Protein name:  Met-enkephalin-Arg-Phe
  • Gene name:  PENK
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0034466 chromaffin granule lumen

Sequence Information

  • Sequence:  YGGFMRF
  • Length:  7(262-268)
  • Propeptide:  MARFLRLCTWLLVLGSCLLATVQAECSQDCAKCSYHLVSPGDINFLACTLECEGQMPSHKIWETCKDLLQVSKPEFPCDSINMFKDSNKQDESHLLAKKYGGFMKRYGGFMKKMDELYPVEPEEEANGGEILAKKYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAREGRHQESTDNDDNMSKRYGGFMRGLKRSPQVEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAESLPSDEEAESYSKEV
  • Signal peptide:  MARFLRLCTWLLVLGSCLLATVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oprm1, Oprd1
  • Target Unid:  A0A1U7Q3K1, A0A1U7QRW6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P50175-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003291_AF2.pdbhor003291_ESM.pdb

Physical Information

Mass: 98422 Formula: C42H56N10O9S
Absent amino acids: ACDEHIKLNPQSTVW Common amino acids: FG
pI: 9.35 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 12.86 Boman Index: -487
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 330 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  NA
  • Title:  NA