General Information

  • ID:  hor003289
  • Uniprot ID:  P50175
  • Protein name:  Met-enkephalin
  • Gene name:  PENK
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0034466 chromaffin granule lumen

Sequence Information

  • Sequence:  YGGFM
  • Length:  5(100-104)
  • Propeptide:  MARFLRLCTWLLVLGSCLLATVQAECSQDCAKCSYHLVSPGDINFLACTLECEGQMPSHKIWETCKDLLQVSKPEFPCDSINMFKDSNKQDESHLLAKKYGGFMKRYGGFMKKMDELYPVEPEEEANGGEILAKKYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAREGRHQESTDNDDNMSKRYGGFMRGLKRSPQVEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAESLPSDEEAESYSKEV
  • Signal peptide:  MARFLRLCTWLLVLGSCLLATVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Oprm1, Oprd1
  • Target Unid:  A0A1U7Q3K1, A0A1U7QRW6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 12.8 minutes; /768 seconds ( PubMed ID: 3215483 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P50175-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003289_AF2.pdbhor003289_ESM.pdb

Physical Information

Mass: 64519 Formula: C27H35N5O7S
Absent amino acids: ACDEHIKLNPQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: 52 Boman Index: 707
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 1570 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  3215483
  • Title:  NA