General Information

  • ID:  hor003252
  • Uniprot ID:  A0A3B3HM52
  • Protein name:  ???Endorphin
  • Gene name:  POMC
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMKSWEEDRQKPLVTLFKNIINKDEQQ
  • Length:  30(183-212)
  • Propeptide:  MYTVWLLVAVVVVGGAEGAVGQCWKHSSCQELDSESSMTECLQLCRSDLTAETPLIPGSSHLQPPPPSDPFSFISPSPQTKRSYSMEHFRWGKPVGRKRRPVKVYTPNGVEEESSEVFPGEMRRRELANELLAAAAEEEERAMEEVEEEEERQHLLAGLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWEEDRQKPLVTLFKNIINKDEQQ
  • Signal peptide:  MYTVWLLVAVVVVGGAEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in modulating medaka behaviors
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  mc4r
  • Target Unid:  H2MEF6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3B3HM52-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003252_AF2.pdbhor003252_ESM.pdb

Physical Information

Mass: 416058 Formula: C164H253N43O49S
Absent amino acids: ACH Common amino acids: K
pI: 6.67 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 8
Hydrophobicity: -109.67 Boman Index: -7476
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 61.67
Instability Index: 5717 Extinction Coefficient cystines: 6990
Absorbance 280nm: 241.03

Literature

  • PubMed ID:  19118555
  • Title:  Mass Spectrometric Map of Neuropeptide Expression and Analysis of the Gamma-Prepro-Tachykinin Gene Expression in the Medaka (Oryzias Latipes) Brain