HORDB

ID: hor003227
Uniprot ID: P05422
Protein name: deltorphin A
Gene name: NA
Organism: Phyllomedusa sauvagei (Sauvage's leaf frog)
Family: Frog skin active peptide (FSAP) family, Dermorphin subfamily
Source: animal
Expression: Expressed by the skin glands.
Disease: NA
Comments: NA
Taxonomy: Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity
GO BP: GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: YMFHLMD
Length: 7
Propeptide: MSFLKKSLLLILFLGLVSLSVCKEEKRETEEENENEENHEEGSEMKRYMFHLMDGEAKKRDSEENEIEENHEEGSEMKRYAFGYPSGEAKKIKRVSEEENENEENHEEGSEMKRYAFGYPSGEAKKIKRESEEEKEIEENHEEGSEMKRYAFGYPSGEAKKIKRESEEENENEENHEEGSEMKRYAFGYPSGEAKKM
Signal peptide: MSFLKKSLLLILFLGLVSLS
Modification: T2 D-methionine;T7 Aspartic acid 1-amide
Glycosylation: NA
Mutagenesis: NA

Function: Dermorphin has a very potent opiate-like activity. It has high affinity and selectivity for mu-type opioid receptors.; Deltorphin has a very potent opiate-like activity. It has high affinity and selectivity for delta-type opioid receptors.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003227_AF2.pdb

hor003227_ESM.pdb

Mass:	106335	Formula:	C44H61N9O11S2
Absent amino acids:	ACEGIKNPQRSTVW	Common amino acids:	M
pI:	5.29	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	2
Hydrophobicity:	34.29	Boman Index:	-92
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	55.71
Instability Index:	7134.29	Extinction Coefficient cystines:	1490
Absorbance 280nm:	248.33