General Information

  • ID:  hor003205
  • Uniprot ID:  P02095
  • Protein name:  hemorphin-4
  • Gene name:  HBB
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Globin family
  • Source:  Animal
  • Expression:  Red blood cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005344 oxygen carrier activity; GO:0019825 oxygen binding; GO:0020037 heme binding; GO:0046872 metal ion binding
  • GO BP:  GO:0015671 oxygen transport
  • GO CC:  GO:0005833 hemoglobin complex

Sequence Information

  • Sequence:  YPWT
  • Length:  4(35-38)
  • Propeptide:  VHLTAAEKSAILDLWGKVNVGEIGAEALGRLLVVYPWTQRFFEKFGDLSSASAIMSNAHVKSHGAKVLASFSEGLKHLQDLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIALAHHHPSEFTPCTQAAFQKVTAGVANALAHKYH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit the binding of 3H-DAMGO (selective for mu opiate receptors) to rat brain and can act as an opiate agonist as well as antagonist.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P02095-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003205_AF2.pdbhor003205_ESM.pdb

Physical Information

Mass: 61931 Formula: C29H35N5O7
Absent amino acids: ACDEFGHIKLMNQRSV Common amino acids: PTWY
pI: 6.09 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 1
Hydrophobicity: -112.5 Boman Index: -38
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 0
Instability Index: -642.5 Extinction Coefficient cystines: 6990
Absorbance 280nm: 2330

Literature

  • PubMed ID:  1359507
  • Title:  Isolation of a Novel Tetrapeptide With Opiate and Antiopiate Activity From Human Brain Cortex: Tyr-Pro-Trp-Gly-NH2 (Tyr-W-MIF-1)