General Information

  • ID:  hor003203
  • Uniprot ID:  C6KGD8
  • Protein name:  Endomorphin-2
  • Gene name:  HSTN
  • Organism:  Bos taurus (Bovine)
  • Family:  Histatin/statherin family
  • Source:  animal
  • Expression:  Expressed in mammary glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPFP
  • Length:  4
  • Propeptide:  MKIFIFIFIMALILAMIRADSSEEKRHRKRKKHHRGYFQQYQPYQRYPLNYPPAYPFP
  • Signal peptide:  MKIFIFIFIMALILAMIRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Analgesia and sedation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C6KGD8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003203_AF2.pdbhor003203_ESM.pdb

Physical Information

Mass: 57628 Formula: C28H34N4O6
Absent amino acids: ACDEGHIKLMNQRSTVW Common amino acids: P
pI: 6.09 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 1
Hydrophobicity: -42.5 Boman Index: 284
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 13465 Extinction Coefficient cystines: 1490
Absorbance 280nm: 496.67

Literature

  • PubMed ID:  20434497
  • Title:  Synthesis and Biological Evaluation of Novel Peripherally Active Morphiceptin Analogs