General Information

  • ID:  hor003199
  • Uniprot ID:  P81117
  • Protein name:  Nesfatin-1
  • Gene name:  NUCB2
  • Organism:  Mus musculus (Mouse)
  • Family:  Nucleobindin family
  • Source:  Animal
  • Expression:  Found in liver, heart, thymus, muscle, intestine, kidney, lung, spleen and throughout the brain, in cerebral cortex, hippocampus, hypothalamus and medulla oblongata. Nucb2 and necdin levels were higher in postmitotic neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001965 G-protein alpha-subunit binding; GO:0003677 DNA binding; GO:0005085 guanyl-nucleotide exchange factor activity; GO:0005164 tumor necrosis factor receptor binding; GO:0005509 calcium ion binding; GO:0046872 metal ion binding
  • GO BP:  GO:0006874 intracellular calcium ion homeostasis; GO:0007264 small GTPase-mediated signal transduction; GO:0032099 negative regulation of appetite; GO:0043951 negative regulation of cAMP-mediated signaling; GO:0045599 negative regulation of fat cell differentiation; GO:0046321 positive regulation of fatty acid oxidation; GO:0046627 negative regulation of insulin receptor signaling pathway; GO:0070093 negative regulation of glucagon secretion; GO:1901142 insulin metabolic process; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005635 nuclear envelope; GO:0005640 nuclear outer membrane; GO:0005737 cytoplasm; GO:0005783 endoplasmic reticulum; GO:0005793 endoplasmic reticulum-Golgi intermediate compartment; GO:0005794 Golgi apparatus; GO:0005797 Golgi medial cisterna; GO:0016020 membrane; GO:0043204 perikaryon

Sequence Information

  • Sequence:  VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
  • Length:  82(25-106)
  • Propeptide:  MRWRIIQVQYCFLLVPCMLTALEAVPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEESKFEEMKRKHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDV
  • Signal peptide:  MRWRIIQVQYCFLLVPCMLTALEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.
  • Mechanism:  Direct regulation of hepatic lipid metabolism by nesfatin-1 through an AMPK-dependent mechanism
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81117-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003199_AF2.pdbhor003199_ESM.pdb

Physical Information

Mass: 1105676 Formula: C424H683N117O137
Absent amino acids: CMW Common amino acids: E
pI: 4.6 Basic residues: 15
Polar residues: 15 Hydrophobic residues: 25
Hydrophobicity: -80.37 Boman Index: -22516
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.32
Instability Index: 5840.61 Extinction Coefficient cystines: 4470
Absorbance 280nm: 55.19

Literature

  • PubMed ID:  26363221
  • Title:  AMPK-dependent Modulation of Hepatic Lipid Metabolism by nesfatin-1