General Information

  • ID:  hor003198
  • Uniprot ID:  P80303
  • Protein name:  Nesfatin-1
  • Gene name:  NUCB2
  • Organism:  Homo sapiens (Human)
  • Family:  Nucleobindin family
  • Source:  Human
  • Expression:  Predominantly expressed in spleen, testis and normal stomach.
  • Disease:  Diseases associated with NUCB2 include Eating Disorder and Type 2 Diabetes Mellitus.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001965 G-protein alpha-subunit binding; GO:0003677 DNA binding; GO:0005085 guanyl-nucleotide exchange factor activity; GO:0005509 calcium ion binding; GO:0005515 protein binding; GO:0046872 metal ion binding
  • GO BP:  GO:0007264 small GTPase-mediated signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005635 nuclear envelope; GO:0005737 cytoplasm; GO:0005783 endoplasmic reticulum; GO:0005793 endoplasmic reticulum-Golgi intermediate compartment; GO:0005794 Golgi apparatus; GO:0005829 cytosol; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0070062 extracellular exosome

Sequence Information

  • Sequence:  VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
  • Length:  82(25-106)
  • Propeptide:  MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDV
  • Signal peptide:  MRWRTILLQYCFLLITCLLTALEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in food intake and energy homeostasis regulation;modulate the cardiovascular function at different levels;promotes insulin release and signaling
  • Mechanism:  NEFA stands for N=DNA-binding; EF=EF-hand; A=Acidic region.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80303-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003198_AF2.pdbhor003198_ESM.pdb

Physical Information

Mass: 1099686 Formula: C427H691N113O134
Absent amino acids: CMW Common amino acids: KDEL
pI: 5.17 Basic residues: 17
Polar residues: 14 Hydrophobic residues: 26
Hydrophobicity: -70.61 Boman Index: -19075
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 103.29
Instability Index: 4114.15 Extinction Coefficient cystines: 4470
Absorbance 280nm: 55.19

Literature

  • PubMed ID:  7811391
  • Title:  Human Protein NEFA, a Novel DNA binding/EF-hand/leucine Zipper Protein. Molecular Cloning and Sequence Analysis of the cDNA, Isolation and Characterization of the Protein.
  • PubMed ID:  26662184
  • Title:  Nesfatin-1: A New Energy-Regulating Peptide With Pleiotropic Functions. Implicatio