General Information

  • ID:  hor003180
  • Uniprot ID:  A0A7M7IPT4
  • Protein name:  RYamide-3
  • Gene name:  107980750
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SEDRNTGNSLRDSSSFFPARY
  • Length:  21(90-110)
  • Propeptide:  MISSSRKIRRVSDYLKLDKLIVWLWISGIFLTLVSSQDNFYASGRFGKRKYALSMSQIPLCSKFDRSEDRSAGNSLKDSSLFSSARFGRSEDRNTGNSLRDSSSFFPARYGRSEDRSTGNSLRDSSSFFPARFGRSEDRSTGNSLKDSSSFSPARYGRSEDRSSGNSLKESSFFSPGRYGRSEGHKNPKELPKFFEIKPRVDQFFIGSRYGKRSLSMLEPQPPLEALHNQRFEAAIDYLDRIKQNLAEAEEIEDE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7IPT4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003180_AF2.pdbhor003180_ESM.pdb

Physical Information

Mass: 276339 Formula: C101H152N32O37
Absent amino acids: CHIKMQVW Common amino acids: S
pI: 6.55 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 4
Hydrophobicity: -132.38 Boman Index: -8837
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 23.33
Instability Index: 6903.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis