General Information

  • ID:  hor003144
  • Uniprot ID:  P13083
  • Protein name:  Pancreatic icosapeptide-like
  • Gene name:  PPY
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SAEEDALGLPVWRQSHAAAPGGSHRHPPAGLPAAKGGTGVSGSPPKPWDCLPCRAHSLPSQS
  • Length:  62(65-126)
  • Propeptide:  MTATRCCLWLLLLGTCMALLLPEAWGAPLEPVYPGDDATPQQMAQYAAEMRRYINMLTRPRYGKSAEEDALGLPVWRQSHAAAPGGSHRHPPAGLPAAKGGTGVSGSPPKPWDCLPCRAHSLPSQS
  • Signal peptide:  MTATRCCLWLLLLGTCMALLLPEAWG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P13083-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003144_AF2.pdbhor003144_ESM.pdb

Physical Information

Mass: 733218 Formula: C271H419N85O82S2
Absent amino acids: FIMNY Common amino acids: PA
pI: 8.27 Basic residues: 9
Polar residues: 19 Hydrophobic residues: 18
Hydrophobicity: -55.81 Boman Index: -8270
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.32
Instability Index: 8120.32 Extinction Coefficient cystines: 11125
Absorbance 280nm: 182.38

Literature

  • PubMed ID:  2830269
  • Title:  Novel Organization and Processing of the Guinea Pig Pancreatic Polypeptide Precursor