General Information

  • ID:  hor003131
  • Uniprot ID:  P48097
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Lampetra fluviatilis (European river lamprey) (Petromyzon fluviatilis)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Lateral brainstem, dorsal spinal cord and retina.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lampetra (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRY
  • Length:  36(35-70)
  • Propeptide:  MMSCFAGTRGSARVWLCAIALCLLASSCARGAAAFPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRYGKRTLTEPYVPEFIFQENRGDRSSNPRFDSVTMW
  • Signal peptide:  MMSCFAGTRGSARVWLCAIALCLLASSCARGAAA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12272-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P12272-F1.pdbhor003131_AF2.pdbhor003131_ESM.pdb

Physical Information

Mass: 479911 Formula: C186H286N54O56
Absent amino acids: CMW Common amino acids: APR
pI: 7.53 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -87.5 Boman Index: -9848
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 73.33
Instability Index: 7303.89 Extinction Coefficient cystines: 4470
Absorbance 280nm: 127.71

Literature

  • PubMed ID:  8028041
  • Title:  Neuropeptide role of both peptide YY and neuropeptide Y in vertebrates suggested by abundant expression of their mRNAs in a cyclostome brain.