General Information

  • ID:  hor003104
  • Uniprot ID:  A0A0L0CNJ2
  • Protein name:  Short neuropeptide F-1
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AQRSPSLRLRF
  • Length:  11(61-71)
  • Propeptide:  MHFQSQLIYKLTLGTFLMLWAQTSAEVLRDEASLNNLYNNLLQREYAGPVVFPNHQVERKAQRSPSLRLRFGRRSDPDLLSQTPEKRWFGEVNQKPIRSPSLRLRFGRRSDPSMPMHSPYDILMNGQQMPENNDDYNEIYDAYYNRVVRKPQRLRFGRSLPFQTMNAVNENDLLESGDDNNDMTLPNSEDEFYNTLIHSQKLRNLLMSLNKYGAGQDNEGMDTAEEDMDEFERAIRKPGPLRLRWGRSTGGRSSM
  • Signal peptide:  MHFQSQLIYKLTLGTFLMLWAQTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0CNJ2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003104_AF2.pdbhor003104_ESM.pdb

Physical Information

Mass: 150909 Formula: C58H99N21O15
Absent amino acids: CDEGHIKMNTVWY Common amino acids: R
pI: 12.8 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -72.73 Boman Index: -4247
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 80
Instability Index: 14150.91 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera