General Information

  • ID:  hor003097
  • Uniprot ID:  B7PVP4
  • Protein name:  Short neuropeptide F
  • Gene name:  NA
  • Organism:  Ixodes scapularis (Black-legged tick) (Deer tick)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ixodes (genus), Ixodinae (subfamily), Ixodidae (family), Ixodoidea (superfamily), Ixodida (order), Parasitiformes (superorder), Acari (subclass), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GGRSPSLRLRF
  • Length:  11
  • Propeptide:  MRDLVELLLKNEQESQLSHTMERKGGRSPSLRLRFGRRSDPAWSDTLHRFLTAGNAGGDSGHSAPAA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B7PVP4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003097_AF2.pdbhor003097_ESM.pdb

Physical Information

Mass: 142398 Formula: C54H92N20O14
Absent amino acids: ACDEHIKMNQTVWY Common amino acids: R
pI: 12.8 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -64.55 Boman Index: -3686
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.91
Instability Index: 15272.73 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19540946
  • Title:  The Neuropeptidomics of Ixodes Scapularis Synganglion