General Information

  • ID:  hor003095
  • Uniprot ID:  Q9VIQ0
  • Protein name:  sNPF-4
  • Gene name:  sNPF
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NPY family
  • Source:  animal
  • Expression:  Expressed throughout development from embryo to adult. |Stage 17 embryos show expression in the two brain hemispheres (neural cells located in the dorsal posterior region), the connected ventral ganglion (pairs of neural cells along the ventral midline) a
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007623 circadian rhythm; GO:0008340 determination of adult lifespan; GO:0008343 adult feeding behavior; GO:0010906 regulation of glucose metabolic process; GO:0030536 larval feeding behavior; GO:0032095 regulation of response to food; GO:0035264 multicellular organism growth; GO:0040014 regulation of multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0045793 positive regulation of cell size; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0090062 regulation of trehalose metabolic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  KPMRLRW
  • Length:  7
  • Propeptide:  MFHLKRELSQGCALALICLVSLQMQQPAQAEVSSAQGTPLSNLYDNLLQREYAGPVVFPNHQVERKAQRSPSLRLRFGRSDPDMLNSIVEKRWFGDVNQKPIRSPSLRLRFGRRDPSLPQMRRTAYDDLLERELTLNSQQQQQQLGTEPDSDLGADYDGLYERVVRKPQRLRWGRSVPQFEANNADNEQIERSQWYNSLLNSDKMRRMLVALQQQYEIPENVASYANDEDTDTDLNNDTSEFQREVRKPMRLRWGRSTGKAPSEQKHTPEETSSIPPKTQN
  • Signal peptide:  MFHLKRELSQGCALALICLVSLQMQQPAQA
  • Modification:  T7 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in controlling food intake and regulating body size.
  • Mechanism:  Flies overexpressing sNPF are heavier and bigger than wild-type. But loss-of-function flies are not smaller than wild-type.
  • Cross BBB:  NA
  • Target:  sNPF-R
  • Target Unid:  Q9VW75
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F4ISE2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-F4ISE2-F1.pdbhor003095_AF2.pdbhor003095_ESM.pdb

Physical Information

Mass: 109344 Formula: C45H75N15O8S
Absent amino acids: ACDEFGHINQSTVY Common amino acids: R
pI: 12.52 Basic residues: 3
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: -138.57 Boman Index: -2579
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 55.71
Instability Index: 8560 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  20575072
  • Title:  Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits.
  • PubMed ID:  15385546
  • Title:  Drosophila Short Neuropeptide F Regulates Food Intake and Body Size