General Information

  • ID:  hor003091
  • Uniprot ID:  NA
  • Protein name:  Neuropeptide F
  • Gene name:  NA
  • Organism:  Daphnia pulex
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DGGDVMSGGEGGEMTAMADAIKYLQGLDKVYGQAARPRF
  • Length:  39
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T39 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003091_AF2.pdbhor003091_ESM.pdb

Physical Information

Mass: 474156 Formula: C173H273N49O58S3
Absent amino acids: CHNW Common amino acids: G
pI: 4.32 Basic residues: 4
Polar residues: 12 Hydrophobic residues: 11
Hydrophobicity: -40.26 Boman Index: -5733
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 57.69
Instability Index: 2760.77 Extinction Coefficient cystines: 2980
Absorbance 280nm: 78.42

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones