General Information

  • ID:  hor003090
  • Uniprot ID:  A0A8C2TNJ6
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0016020 membrane

Sequence Information

  • Sequence:  SSPETLISDLLLR
  • Length:  13(114-126)
  • Propeptide:  MQQVVQFGIPHRVRRDWKTFVKWFKGSGSTPAKQILAGTPRCHRSRMQGTMRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLLRESTENIPRSRYVFYSAFHF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003090_AF2.pdbhor003090_ESM.pdb

Physical Information

Mass: 165788 Formula: C63H110N16O22
Absent amino acids: ACFGHKMNQVWY Common amino acids: L
pI: 4.18 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 5
Hydrophobicity: 26.92 Boman Index: -1862
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 150
Instability Index: 8603.08 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon