General Information

  • ID:  hor003081
  • Uniprot ID:  NA
  • Protein name:  Pancreatic polypeptide
  • Gene name:  NA
  • Organism:  Suncus murinus
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APLEPAYPGDNATPEQMAQYAAELRKYINMVTRPRY
  • Length:  36
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003081_AF2.pdbhor003081_ESM.pdb

Physical Information

Mass: 475114 Formula: C183H282N50O55S2
Absent amino acids: CFHSW Common amino acids: A
pI: 6.62 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -81.94 Boman Index: -7422
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 57.22
Instability Index: 5144.17 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  12832102
  • Title:  Analysis of Pancreatic Polypeptide cDNA From the House Musk Shrew, Suncus Murinus, Suggests a Phylogenetically Closer Relationship With Humans Than for Other Small Laboratory Animal Species