General Information

  • ID:  hor003079
  • Uniprot ID:  P41519
  • Protein name:  Pancreatic polypeptide
  • Gene name:  PPY
  • Organism:  Chinchilla chinchilla (Short-tailed chinchilla) (Chinchilla brevicaudata)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Chinchilla (genus), Chinchillidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY
  • Length:  36
  • Propeptide:  APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8MQ92-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-A8MQ92-F1.pdbhor003079_AF2.pdbhor003079_ESM.pdb

Physical Information

Mass: 483926 Formula: C185H286N52O55S3
Absent amino acids: CFHKSW Common amino acids: AP
pI: 6.62 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -83.33 Boman Index: -8305
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 5807.78 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  2235678
  • Title:  Purification of Peptide Hormones From Chinchilla Pancreas by Chemical Assay