General Information

  • ID:  hor003073
  • Uniprot ID:  P30990
  • Protein name:  Neuromedin N
  • Gene name:  NTS
  • Organism:  Homo sapiens (Human)
  • Family:  Neurotensin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with NTS include Dumping Syndrome and Duodenogastric Reflux.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0051092 positive regulation of NF-kappaB transcription factor activity; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence Information

  • Sequence:  IPYIL
  • Length:  5(144-148)
  • Propeptide:  MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
  • Signal peptide:  MMAGMKIQLVCMLLLAFSSWSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NTSR1
  • Target Unid:  P30989
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3ECL0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q3ECL0-F1.pdbhor003073_AF2.pdbhor003073_ESM.pdb

Physical Information

Mass: 68932 Formula: C32H51N5O7
Absent amino acids: ACDEFGHKMNQRSTVW Common amino acids: I
pI: 6.09 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: 198 Boman Index: 1462
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 234
Instability Index: 4076 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  NA
  • Title:  NA