HORDB

ID: hor003072
Uniprot ID: P01156
Protein name: Neurotensin
Gene name: NTS
Organism: Bos taurus (Bovine)
Family: Neurotensin family
Source: animal
Expression: Brain and gut.
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence: QLYENKPRRPYIL
Length: 13
Propeptide: MMAGMKIQLVCMILLAFSSWSLCSDSEEEMKALETDLLTNMHTSKISKASVPSWKMSLLNVCSLINNLNSQAEETGEFHEEELITRRKFPAALDGFSLEAMLTIYQLQKICHSRAFQHWELIQEDILDAGNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
Signal peptide: MMAGMKIQLVCMILLAFSSWSLC
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle
Mechanism: NA
Cross BBB: NA
Target: NTSR1
Target Unid: F1MWG2
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-A8MQI8-F1.pdb

hor003072_AF2.pdb

hor003072_ESM.pdb

Mass:	190419	Formula:	C78H124N22O20
Absent amino acids:	ACDFGHMSTVW	Common amino acids:	LPRY
pI:	10.01	Basic residues:	3
Polar residues:	3	Hydrophobic residues:	3
Hydrophobicity:	-131.54	Boman Index:	-3990
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	90
Instability Index:	8373.85	Extinction Coefficient cystines:	2980
Absorbance 280nm:	248.33