General Information

  • ID:  hor003051
  • Uniprot ID:  P0C0P8
  • Protein name:  Neuropeptide S
  • Gene name:  Nps
  • Organism:  Mus musculus (Mouse)
  • Family:  Neuropeptide S family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0035249 synaptic transmission, glutamatergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  SFRNGVGSGAKKTSFRRAKQ
  • Length:  20
  • Propeptide:  MIGSLKLSFVLALSLSVMHVLWCYPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTSFRRAKQ
  • Signal peptide:  MIGSLKLSFVLALSLSVMHVLWC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an important anorexigenic role. Modulates arousal and anxiety as well as increases locomotor activity. Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npsr1
  • Target Unid:  Q8BZP8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8MRD4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-A8MRD4-F1.pdbhor003051_AF2.pdbhor003051_ESM.pdb

Physical Information

Mass: 252153 Formula: C93H156N34O27
Absent amino acids: CDEHILMPWY Common amino acids: GKRS
pI: 12.82 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: -115.5 Boman Index: -6992
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 24.5
Instability Index: 4014.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA