General Information

  • ID:  hor003050
  • Uniprot ID:  P0C0P6
  • Protein name:  Neuropeptide S
  • Gene name:  Nps
  • Organism:  Homo sapiens (Human)
  • Family:  Neuropeptide S family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0035249 synaptic transmission, glutamatergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  SFRNGVGTGMKKTSFQRAKS
  • Length:  20
  • Propeptide:  MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS
  • Signal peptide:  MISSVKLNLILVLSLSTMHVFWC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPSR1
  • Target Unid:  Q6W5P4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O48776-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-O48776-F1.pdbhor003050_AF2.pdbhor003050_ESM.pdb

Physical Information

Mass: 252656 Formula: C93H155N31O28S
Absent amino acids: CDEHILPWY Common amino acids: GKS
pI: 12.55 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: -96 Boman Index: -5703
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 19.5
Instability Index: -458 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA