HORDB

ID: hor003046
Uniprot ID: Q8K1M5
Protein name: Neuropeptide W-30
Gene name: NPW
Organism: Rattus norvegicus (Rat)
Family: Neuropeptide B/W family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
GO CC: GO:0005576 extracellular region

Sequence: WYKHVASPRYHTVGRASGLLMGLRRSPYLW
Length: 30
Propeptide: MDLSALASSREVRGPGPGAPVNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYLWRRALGGAAGPLVGLPGQMARSALLLPSPGQELWEVRSRSSPAGLPVHATRSLRDLEGAGQPEQSLSFQSWTSAEPAARAFGETLRAQPWFLQQIIFADPVRLDDRLKNRWRPRA
Signal peptide: MDLSALASSREVRGPGPGAPVNRPLLPLLLLLLLLPLPASA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress. When injected into the lateral cerebroventricle, it elevates prolactin (PRL) and corticosterone and lowers growth hormone (GH) release.
Mechanism: NA
Cross BBB: NA
Target: Npbwr1
Target Unid: Q56UD9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q0V822-F1.pdb

hor003046_AF2.pdb

hor003046_ESM.pdb

Mass:	407659	Formula:	C165H249N49O38S
Absent amino acids:	CDEFINQ	Common amino acids:	LR
pI:	11.44	Basic residues:	7
Polar residues:	10	Hydrophobic residues:	10
Hydrophobicity:	-41.33	Boman Index:	-4653
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	78
Instability Index:	8075.67	Extinction Coefficient cystines:	15470
Absorbance 280nm:	533.45